PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_23370V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YC
Protein Properties Length: 378aa    MW: 41344.2 Da    PI: 4.0029
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_23370V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC461.2e-142413112090
               NF-YC  20 elPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifd 90 
                         ++P++r+k+i+k d+dv+ +s++a +l+++a  lf+  l+  s+    ++kr+t++  d+  a ++t  f 
  Pp3c13_23370V3.1.p 241 AFPITRVKRIIKLDKDVRLVSSDALALITQATALFVQSLSSASFKVMLQSKRKTIRGPDVILAAKSTRQFR 311
                         69*************************************************************99999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.2E-15242303IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.101.0E-16242310IPR009072Histone-fold
SuperFamilySSF471132.97E-15242311IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MARKEEIDAV SCAIMCMDTL AMDSMDMNPE EFPNTNASPV IPTGPPSKDL TNSDSCVDER  60
PQRGKELENS VGSGGAEQTC YDDEGLMTDP GTPDSHGSPD TPGSPEELHD LIETKDMNLD  120
MTENDLDEEK GYDENGLMTN LSTPDNPGTP RDEFSDDSHE LDETKDANLD IIENDLGESG  180
TDDDAQDTDP VTPQEGLPRY GDDPDETKDM NVDGAEKSFE MLDDGQDEGE KSFDGERFVP  240
AFPITRVKRI IKLDKDVRLV SSDALALITQ ATALFVQSLS SASFKVMLQS KRKTIRGPDV  300
ILAAKSTRQF RECLENDLAT LLEESNQDTA NGEDIPVEKE HGTSGEPTRK RSQQPKSSKK  360
QQLAPPGSRP ITIFFKT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.184740.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S37_218V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43250.11e-11nuclear factor Y, subunit C13